CJC1295 with out DAC

Name	CJC-1295 without DAC
Synonyms	CJC1295 CJC-1295(2MG) CJC-1295 Acetate CJC-1295 CJC-1295 CJC-1295 without DAC CJC1295 with out DAC Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide
CAS	863288-34-0
EINECS	206-141-6

Molecular Formula	C152H252N44O42
Molar Mass	3367.89688
Density	1.45
Melting Point	> 177° C (dec.)
Solubility	Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
Appearance	Solid
Color	White to Off-White
Storage Condition	-20°C Freezer, Under inert atmosphere
Physical and Chemical Properties	Appearance: white powder
Use	Sequence: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2

Spot supply

Product Name: CJC1295 Visit Supplier Webpage Request for quotation
CAS: 863288-34-0
Tel: +86 0571-86722205
Email: sales@chinaskyrun.com
Mobile: +8618958170122
QQ: 2531159185

Send QQ message
Wechat: chinaskyrun

Product Name: CJC-1295 without DAC Request for quotation
CAS: 863288-34-0
Tel: 15623179893
Email: 2546448228@qq.com
Mobile: 15623179893

Product Name: CJC-1295 without DAC Request for quotation
CAS: 863288-34-0
Tel: 008655165326643
Email: qilin@cellmano.com
Mobile: 008618156095617
QQ: 1761863581

Send QQ message

Spot supply

Product Name: CJC1295 Visit Supplier Webpage Request for quotation
CAS: 863288-34-0
Tel: +86 0571-86722205
Email: sales@chinaskyrun.com
Mobile: +8618958170122
QQ: 2531159185

Send QQ message
Wechat: chinaskyrun

Product Name: CJC-1295 without DAC Request for quotation
CAS: 863288-34-0
Tel: 15623179893
Email: 2546448228@qq.com
Mobile: 15623179893

Product Name: CJC-1295 without DAC Request for quotation
CAS: 863288-34-0
Tel: 008655165326643
Email: qilin@cellmano.com
Mobile: 008618156095617
QQ: 1761863581

Send QQ message

View History

CJC1295 with out DAC
MINERAL WAX
emulsifier OPE-3

CJC1295 with out DAC Request for Quotation